Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQE ENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGL TFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSL VKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPG LDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPR DILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETK LSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGK CQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFC LRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
    • Molecular weight

      70 kDa including tags
    • Amino acids

      2 to 444
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab238226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • EVH1 domain-containing protein 1
    • EVH1/Sprouty domain containing protein
    • FLJ33903
    • hSpred 1
    • hSpred1
    • NFLS
    • PPP1R147
    • protein phosphatase 1 regulatory subunit 147
    • SPRE1_HUMAN
    • SPRED 1
    • Spred-1
    • spred1
    • Sprouty related EVH1 domain containing 1
    • sprouty related EVH1 domain containing protein 1
    • Sprouty related protein 1 with EVH 1 domain
    • Sprouty-related
    • Suppressor of Ras/MAPK activation
    see all
  • Function

    Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.
  • Tissue specificity

    Weakly expressed in embryonic cell line (HEK-293).
  • Involvement in disease

    Defects in SPRED1 are the cause of Legius syndrome (LEGIUSS) [MIM:611431]. It is a disorder characterized mainly by cafe au lait macules without neurofibromas or other tumor manifestations of neurofibromatosis type 1, axillary freckling, and macrocephaly. Additional clinical manifestations include Noonan-like facial dysmorphism, lipomas, learning disabilities and attention deficit-hyperactivity.
  • Sequence similarities

    Contains 1 KBD domain.
    Contains 1 SPR (sprouty) domain.
    Contains 1 WH1 domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine.
  • Cellular localization

    Cell membrane. Membrane > caveola. Nucleus. Localized in cholesterol-rich membrane raft/caveola fractions.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238226.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238226 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPRED1.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238226 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPRED1.

References

ab238226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up