Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGS NEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHA VLPSNARGPI
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Sprouty 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hSPRY1
    • Protein sprouty homolog 1
    • Sprouty 1
    • Sprouty homolog 1
    • Sprouty homolog 1 antagonist of FGF signaling
    • Spry-1
    • Spry1
    • SPY1_HUMAN
    see all
  • Function

    May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.
  • Sequence similarities

    Belongs to the sprouty family.
    Contains 1 SPR (sprouty) domain.
  • Domain

    The Cys-rich domain is responsible for the localization of the protein to the membrane ruffles.
  • Cellular localization

    Cytoplasm. Membrane. Found in the cytoplasm in unstimulated cells but is translocated to the membrane ruffles in cells stimulated with EGF.
  • Information by UniProt

Images

  • ab153065 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up