Description

  • Product name

    Recombinant Human Spry-2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIR NTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVH SSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSFSSGPVADGII RVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWI CDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCC TRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC CKVPTVPPRNFEKPT
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 315

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

    Previously labelled as Sprouty 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hSPRY 2
    • hSPRY2
    • MGC23039
    • Protein sprouty homolog 2
    • Sprouty 2
    • Sprouty homolog 2
    • Sprouty homolog 2 (Drosophila)
    • Sprouty2
    • Spry 2
    • Spry-2
    • SPRY2
    • SPY2_HUMAN
    see all
  • Function

    May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.
  • Sequence similarities

    Belongs to the sprouty family.
    Contains 1 SPR (sprouty) domain.
  • Domain

    The Cys-rich domain is responsible for the localization of the protein to the membrane ruffles.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > ruffle membrane. Associated with microtubules in unstimulated cells but is translocated to the membrane ruffles in cells stimulated ith EGF.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131855 stained with Coomassie Blue.

References

ab131855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up