Recombinant Human SPRYD5 protein (ab164658)

Overview

  • Product name

    Recombinant Human SPRYD5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      METTRTRCWKDYVSLRIEAIRAEYQKMPAFLHEEEQHHLERLRKEGEDIF QQLNESKARMEHSRELLRGMYEDLKQMCHKADVELLQAFGDILHRYESLL LQVSEPVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSM NVGCDPQDDPDITGKSECFLVWGAQAFTSGKYYWEVHMGDSWNWAFGVCN NYWKEKRQNDKIDGEEGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTV GLFLDCEGRTVSFVDVDQSSLIYTIPNCSFSPPLRPIFCCSHF
    • Amino acids

      1 to 293
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC10977
    • SPRY domain containing 5
    • SPRY domain containing protein 5
    • SPRY domain-containing protein 5
    • SPRY5_HUMAN
    • SPRYD5
    • TRIM51
    • TRIM51A
    • Tripartite motif containing 51
    • Tripartite motif containing protein 51
    • Tripartite motif-containing protein 51
    see all
  • Sequence similarities

    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Information by UniProt

Images

  • ab164658 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up