Description

  • Product name

    Recombinant human Sps1/Ste20 related kinase 4 protein
  • Biological activity

    The specific activity of ab190389 was determined to be 38 nmol/min/mg.

  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFGKTLSGTNSISQEIMDSVNNEELTDELLGCLAAELLALDEKDNNSCQK MANETDPENLNLVLRWRGSTPKEMGRETTKVKIQRHSSGLRIYDREEKFL ISNEKKIFSENSLKSEEPILWTKGEILGKGAYGTVYCGLTSQGQLIAVKQ VALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFM EFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGN NVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVIN ESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLP DHFSENAADFVRMCLTRDQHERPSALQLLKHSFLERSH
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      941 to 1328
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      NM_025052.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab190389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.1% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • mitogen-activated protein kinase kinase kinase 19
    • RCK
    • regulated in COPD kinase
    • Regulated in COPD, protein kinase
    • SPS1/STE20-related protein kinase YSK4
    • Yeast Sps1/Ste20 related kinase 4
    • YSK4
    • YSK4 Sps1/Ste20-related kinase homolog
    see all
  • Relevance

    Sps1/Ste20 related kinase 4 belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family, STE20 subfamily. It contains one protein kinase domain. There are six isoforms.

Images

  • SDS PAGE analysis of ab190389
  • The specific activity of Sps1/Ste20 related kinase 4 (ab190389) was determined to be 44 nmol/min/mg as per activity assay protocol.

  • SDS-PAGE analysis of ab190389.

  • Kinase assay showing the specific activity of ab190389 as 38 nmol/min/mg.

References

ab190389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up