Overview

  • Product name
    Recombinant Human SR-25 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKV VDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
    • Amino acids
      261 to 360
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ARL6IP4. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation like factor 6 interacting protein 4
    • ADP-ribosylation factor-like protein 6-interacting protein 4
    • Aip-4
    • AR6P4_HUMAN
    • ARL-6-interacting protein 4
    • Arl6ip4
    • HSP-975
    • HSVI-binding protein
    • SFRS20
    • Splicing factor arginine/serine rich 20
    • Splicing factor SRrp37
    • Splicing regulator SRrp38
    • SR-15
    • SR-25
    • SRp25
    • SRp25 nuclear protein
    • SRrp37
    see all
  • Function
    In case of infection by Herpes simplex virus (HSVI), may act as a splicing inhibitor of HSVI pre-mRNA.
  • Sequence similarities
    Belongs to the ARL6IP4 family.
  • Developmental stage
    Expressed only in G1/S phase.
  • Information by UniProt

Images

  • ab162512 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up