Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADD AVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRD KYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGV IEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRS RRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSK PKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
    • Amino acids
      1 to 344
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • arginine/serine-rich 6
    • B52
    • Epididymis secretory protein Li 91
    • fc17h09
    • HEL S 91
    • MGC128807
    • MGC5045
    • Pre mRNA splicing factor SRP55
    • Pre-mRNA-splicing factor SRP55
    • Serine/arginine-rich splicing factor 6
    • SFRS6
    • Splicing factor
    • Splicing factor arginine/serine rich 55 kDa
    • Splicing factor arginine/serine rich 6
    • SR splicing factor 6
    • SRP55
    • SRSF6
    • SRSF6_HUMAN
    • wu:faa54g02
    • wu:fc17h09
    • zgc:103497
    see all
  • Function
    Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159499 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up