Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELH RQERLRNHERIRLKPGHVPYCDLCKGLSGHLPGVRQRAIVRCQTCKINLC LECQKRTHSGGNKRRHPVTVYNVSNLQESLEAEEMDEETKRKKMTEKVVS FLLVDENEEIQVTNEEDFIRKLDCKPDQHLKVVSIFGNTGDGKSHTLNHT FFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLLGATVNLSQRT RLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRF PEAFSSIHYKGTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKAL KALSDRFSGEIPDDQMAHSSFFPDEYFTCSSLCLSCGVGCKKSMNHGKEG VPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGLA KYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFL KDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ ILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRV CDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPL GLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHHCRACGQGFCDECSH DRRAVPSRGWDHPVRVCFNCNKKPGDL
    • Amino acids
      1 to 777
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ZFYVE1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DFCP1
    • Double FYVE containing protein 1
    • KIAA1589
    • Phosphoinositide binding protein SR3
    • SR3
    • TAFF1
    • Tandem FYVE fingers 1
    • ZFYVE 1
    • ZFYVE1
    • Zinc finger FYVE domain containing protein 1
    • Zinc finger protein subfamily 2A (FYVE domain containing) 1
    • Zinc finger protein subfamily 2A member 1
    • ZNFN2A1
    see all
  • Relevance
    SR3 contains two zinc-binding FYVE domains in tandem. The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signalling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. There are two named isoforms of SR3.
  • Cellular localization
    Golgi apparatus, Golgi stack. Note: Resides predominantly in the cisternal stacks of the Golgi.

Images

  • ab162686 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up