Recombinant human Src protein (ab79635)
Key features and details
- Expression system: Baculovirus infected Sf9 cells
- Purity: > 85% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE, WB
Description
-
Product name
Recombinant human Src protein
See all Src proteins and peptides -
Biological activity
Activity: 1007 pmol/min/µg. Assay conditons: 40 mM Tris-HCl pH 7.4, 20 mM MgCl2, 0.1 mg/mL BSA and 1 mM DTT using 0.2 mg/ml Poly(Glu:Tyr) substrate and 20 uM ATP. Reaction was done at 30°C for 35 min.
-
Purity
> 85 % SDS-PAGE.
Affinity purified. -
Expression system
Baculovirus infected Sf9 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MHHHHHHGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASA DGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYD YESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDF DNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL TTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYM SKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAAN ILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTI KSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESL HDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL -
Predicted molecular weight
61 kDa including tags -
Amino acids
2 to 536 -
Tags
His tag N-Terminus -
Additional sequence information
NM_005417 61 KDa including tag
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab79635 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Preservative: 0.851% Imidazole
Constituents: 0.04627% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.394% Tris HCl, 50% Glycerol (glycerin, glycerine), 0.403% Sodium chloride, 0.01006% Potassium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- ASV
- Avian sarcoma virus
- AW259666
see all -
Function
Non-receptor protein tyrosine kinase that plays pivotal roles in numerous cellular processes such as proliferation, migration, and transformation. In concert with PTK2B, plays an important role in osteoclastic bone resorption. Both the formation of a SRC-PTK2B complex, and SRC kinase activity are necessary for this function. Once it is recruited to the activated integrins, by PTK2B, it phosphorylates CBL which in turn induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function. Promotes energy production in osteoclasts by activating mitochondrial cytochrome C oxidase. Phosphorylates RUNX3 and COX2 on tyrosine residues, TNK2 on 'Tyr-284' and CBL on 'Tyr-731'. Enhances DDX58/RIG-I-elicited antiviral signaling. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
Contains 1 protein kinase domain.
Contains 1 SH2 domain.
Contains 1 SH3 domain. -
Post-translational
modificationsDephosphorylated at Tyr-530 by PTPRJ (By similarity). Phosphorylated on Tyr-530 by c-Src kinase (CSK). The phosphorylated form is termed pp60c-src. Dephosphorylated by PTPRJ at Tyr-419. Normally maintained in an inactive conformation with the SH2 domain engaged with Tyr-530, the SH3 domain engaged with the SH2-kinase linker, and Tyr-419 dephosphorylated. Dephosphorylation of Tyr-530 as a result of protein tyrosine phosphatase (PTP) action disrupts the intramolecular interaction between the SH2 domain and Tyr-530, Tyr-419 can then become autophosphorylated, resulting in SRC activation. Phosphorylation of Tyr-530 by CSK allows this interaction to reform, resulting in SRC inactivation.
S-nitrosylation is important for activation of its kinase activity. -
Cellular localization
Cell membrane. Mitochondrion inner membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab79635 has been referenced in 1 publication.
- Luo J et al. Rho GDP-Dissociation Inhibitor 2 Inhibits C-X-C Chemokine Receptor Type 4-Mediated Acute Lymphoblastic Leukemia Cell Migration. Front Oncol 10:1512 (2020). PubMed: 32903764