For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-src-protein-ab79635.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Tyrosine Kinases Src Family
Share by email

Recombinant human Src protein (ab79635)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human Src protein (ab79635)
  • Functional Studies - Recombinant human Src protein (ab79635)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: > 85% SDS-PAGE
  • Active: Yes
  • Tags: His tag N-Terminus
  • Suitable for: Functional Studies, SDS-PAGE, WB

You may also be interested in

Protein
Product image
Recombinant human PI3K(p110alpha/p55gamma) protein (Active) (ab127617)
Primary
Product image
Anti-Src (phospho Y419) antibody [EPR17734] (ab185617)
Pair
Product image
Human Src (pY416) Antibody Pair - BSA and Azide free (ab253321)

View more associated products

Description

  • Product name

    Recombinant human Src protein
    See all Src proteins and peptides
  • Biological activity

    Activity: 1007 pmol/min/µg. Assay conditons: 40 mM Tris-HCl pH 7.4, 20 mM MgCl2, 0.1 mg/mL BSA and 1 mM DTT using 0.2 mg/ml Poly(Glu:Tyr) substrate and 20 uM ATP. Reaction was done at 30°C for 35 min.

  • Purity

    > 85 % SDS-PAGE.
    Affinity purified.
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    P12931
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASA DGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYD YESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDF DNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL TTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYM SKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAAN ILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTI KSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESL HDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      2 to 536
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_005417 61 KDa including tag

Associated products

  • Related Products

    • Anti-Src antibody [Clone 327] (ab16885)
    • Anti-Src antibody (ab47405)

Specifications

Our Abpromise guarantee covers the use of ab79635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.851% Imidazole
    Constituents: 0.04627% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.394% Tris HCl, 50% Glycerol (glycerin, glycerine), 0.403% Sodium chloride, 0.01006% Potassium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ASV
    • Avian sarcoma virus
    • AW259666
    • c SRC
    • CDNA FLJ14219 fis clone NT2RP3003800 highly similar to Rattus norvegicus tyrosine protein kinase pp60 c src mRNA
    • cSrc
    • EC 2.7.10.2
    • Neuronal CSRC tyrosine specific protein kinase
    • Neuronal proto-oncogene tyrosine-protein kinase Src
    • Neuronal SRC
    • Oncogene SRC
    • OTTHUMP00000174476
    • OTTHUMP00000174477
    • p60 Src
    • p60-Src
    • p60c-src
    • p60Src
    • pp60c src
    • pp60c-src
    • pp60csrc
    • Proto oncogene tyrosine protein kinase Src
    • Proto-oncogene c-Src
    • Proto-oncogene tyrosine-protein kinase Src
    • Protooncogene SRC
    • Protooncogene SRC Rous sarcoma
    • Src
    • SRC Oncogene
    • SRC proto oncogene non receptor tyrosine kinase
    • SRC_HUMAN
    • SRC1
    • Tyrosine kinase pp60c src
    • Tyrosine protein kinase SRC 1
    • Tyrosine protein kinase SRC1
    • v src avian sarcoma (Schmidt Ruppin A2) viral oncogene homolog
    • V src sarcoma (Schmidt Ruppin A 2) viral oncogene homolog (avian)
    • v src sarcoma (Schmidt Ruppin A 2) viral oncogene homolog avian
    see all
  • Function

    Non-receptor protein tyrosine kinase that plays pivotal roles in numerous cellular processes such as proliferation, migration, and transformation. In concert with PTK2B, plays an important role in osteoclastic bone resorption. Both the formation of a SRC-PTK2B complex, and SRC kinase activity are necessary for this function. Once it is recruited to the activated integrins, by PTK2B, it phosphorylates CBL which in turn induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function. Promotes energy production in osteoclasts by activating mitochondrial cytochrome C oxidase. Phosphorylates RUNX3 and COX2 on tyrosine residues, TNK2 on 'Tyr-284' and CBL on 'Tyr-731'. Enhances DDX58/RIG-I-elicited antiviral signaling.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Dephosphorylated at Tyr-530 by PTPRJ (By similarity). Phosphorylated on Tyr-530 by c-Src kinase (CSK). The phosphorylated form is termed pp60c-src. Dephosphorylated by PTPRJ at Tyr-419. Normally maintained in an inactive conformation with the SH2 domain engaged with Tyr-530, the SH3 domain engaged with the SH2-kinase linker, and Tyr-419 dephosphorylated. Dephosphorylation of Tyr-530 as a result of protein tyrosine phosphatase (PTP) action disrupts the intramolecular interaction between the SH2 domain and Tyr-530, Tyr-419 can then become autophosphorylated, resulting in SRC activation. Phosphorylation of Tyr-530 by CSK allows this interaction to reform, resulting in SRC inactivation.
    S-nitrosylation is important for activation of its kinase activity.
  • Cellular localization

    Cell membrane. Mitochondrion inner membrane.
  • Target information above from: UniProt accession P12931 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human Src protein (ab79635)
    SDS-PAGE - Recombinant human Src protein (ab79635)
    ab79635 on SDS-PAGE, Molecular Weight 60.5 kDa
    10% SDS-PAGE, Coomassie staining
    Lane 1: ab79635 6µg
    Lane 2: Protein marker
  • Functional Studies - Recombinant human Src protein (ab79635)
    Functional Studies - Recombinant human Src protein (ab79635)

    Kinase assay - Specific activity 1007 pmol/min/µg

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab79635? Please let us know so that we can cite the reference in this datasheet.

ab79635 has been referenced in 1 publication.

  • Luo J  et al. Rho GDP-Dissociation Inhibitor 2 Inhibits C-X-C Chemokine Receptor Type 4-Mediated Acute Lymphoblastic Leukemia Cell Migration. Front Oncol 10:1512 (2020). PubMed: 32903764

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab79635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.