Description

  • Product name

    Recombinant Human SRD5A3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLI RYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFL GAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYV SVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQAR WFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEY VSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK SKFVSYPKHRKAFLPFLF
    • Amino acids

      1 to 318
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3-oxo-5-alpha-steroid 4-dehydrogenase 3
    • CDG1P
    • probable polyprenol reductase
    • S5AR 3
    • SR type 3
    • SRD5A2L
    • SRD5A2L1
    • steroid 5 alpha reductase 2 like
    • steroid 5 alpha-reductase 3
    see all
  • Relevance

    Probable polyprenol reductase. Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Probably acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
  • Cellular localization

    Cytoplasmic. Integral to endoplasmic reticulum membrane.

Images

  • ab164060 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up