Recombinant Human SREBP2 protein (ab114215)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human SREBP2 protein
See all SREBP2 proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDS VGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT -
Predicted molecular weight
37 kDa including tags -
Amino acids
801 to 900
-
Specifications
Our Abpromise guarantee covers the use of ab114215 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- AI608257
- bHLHd2
- Class D basic helix-loop-helix protein 2
see all -
Function
Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the cholesterol and to a lesser degree the fatty acid synthesis pathway (By similarity). Binds the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') found in the flanking region of the LDRL and HMG-CoA synthase genes. -
Tissue specificity
Ubiquitously expressed in adult and fetal tissues. -
Sequence similarities
Belongs to the SREBP family.
Contains 1 basic helix-loop-helix (bHLH) domain. -
Post-translational
modificationsAt low cholesterol the SCAP/SREBP complex is recruited into COPII vesicles for export from the ER. In the Golgi complex SREBPs are cleaved sequentially by site-1 and site-2 protease. The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain and releases the transcription factor from the Golgi membrane. Apoptosis triggers cleavage by the cysteine proteases caspase-3 and caspase-7. -
Cellular localization
Nucleus and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle > COPII-coated vesicle membrane. Moves from the endoplasmic reticulum to the Golgi in the absence of sterols. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human SREBP2 protein (ab114215)ab114215 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.
Datasheets and documents
References
ab114215 has not yet been referenced specifically in any publications.
