Recombinant Human SRFBP1 protein (ab165662)

Overview

  • Product name
    Recombinant Human SRFBP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLK NQRRAQRLLEEIHAMKELKPDIVTKSALGDDINFEKIFKKPDSTATERAI ARLAVHPLLKKKIDVLKAAVQAFKEARQNVAEVESSKNASEDNHSENTLY SNDNGSNLQREATVISEQKVKETKILAKKPIHNSKEKIAKMEHGPKAVTI ANSPSKPSEKDSVVSLESQKTPADPKLKTLSQTKKNKGSDSSLSGNSDGG EEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC HSSVKEQKPLEKVFLKEDTGETHGDTRNDKIKPSTETRKLESVFFHSLSG SKSSRRNFKEQAPKTRSLDFPQNEPQIKNQFNKKLSGRLENTKQQLQLPL HPSWEASRRRKEQQSNIAVFQGKKITFDD
    • Amino acids
      1 to 429
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • p49
    • p49 / STRAP
    • p49/STRAP
    • serum response factor binding protein 1
    • Serum response factor-binding protein 1
    • SRF dependent transcription regulation associated protein
    • SRF-dependent transcription regulation-associated protein
    • SRFB1_HUMAN
    • SRFBP 1
    • SRFBP1
    see all
  • Function
    May be involved in regulating transcriptional activation of cardiac genes during the aging process. May play a role in biosynthesis and/or processing of SLC2A4 in adipose cells.
  • Tissue specificity
    Abundantly expressed in heart and skeletal muscle, and at much lower levels in brain and lung.
  • Developmental stage
    Up-regulated in adult heart (at protein level).
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • ab165662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up