Recombinant human SRGAP3 + BRAF protein (ab205991)

Description

  • Product name

    Recombinant human SRGAP3 + BRAF protein
  • Biological activity

    The specific activity of ab205991 was determined to be 250 nmol/min/mg.

  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQ EFFRRKAEIELEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWY LVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMH EELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDLSM NLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAAT NAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD VIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQP VQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSD AFQHSRSTESVKSAASETYMSKINIAKRRANQQETEMFYFTKFKEYVNGS NLITKLQAKHDLLKQTLGEGERAECGTTRPPCLPPKPQKMRRPRPLSVYS HKLFNGSMEAFIK

      DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNV KALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRI GSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNI LLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQG MDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQL SGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILAS IELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAF PVH

    • Predicted molecular weight

      128 kDa including tags
    • Amino acids

      1 to 513
    • Tags

      GST tag N-Terminus
    • Amino Acid Sequence 2

    • Species

      Human
    • Amino acids

      381 to 766

Specifications

Our Abpromise guarantee covers the use of ab205991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • The specific activity of SRGAP3 + BRAF (ab205991) was determined to be 118 nmol/min/mg as per activity assay protocol and was equivalent to 252 nmol/min/mg as per radiometric assay
  • SDS PAGE analysis of ab205991
  • SDS PAGE analysis of ab205991
  • SDS-PAGE analysis of ab205991.

  • Sample Kinase Activity Plot. The specific activity of ab205991 was determined to be 250 nmol/min/mg.

References

ab205991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up