Overview

  • Product name

    Recombinant Human SRPR alpha protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHE ALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQ QSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVR SMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAEKSGLPVGPEN GVELSKEELIRRKREEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWEL GGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLI AKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQ RRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVL IAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAG IAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFV GEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA
    • Molecular weight

      96 kDa including tags
    • Amino acids

      1 to 638

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Docking protein alpha
    • DP
    • DP alpha
    • DP-alpha
    • DPalpha
    • MGC17355
    • MGC3650
    • MGC9571
    • Signal recognition particle receptor
    • signal recognition particle receptor (docking protein)
    • Signal recognition particle receptor alpha subunit
    • Signal recognition particle receptor subunit alpha
    • SR alpha
    • SR-alpha
    • SRalpha
    • SRP alpha
    • SRPalpha
    • SRPR
    • SRPR_HUMAN
    see all
  • Function

    Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
  • Sequence similarities

    Belongs to the GTP-binding SRP family.
  • Cellular localization

    Endoplasmic reticulum membrane. Thought to be anchored in the membrane through an interaction with SR-beta, which contains a bona fide transmembrane domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132172 stained with Coomassie Blue.

References

ab132172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up