Overview

  • Product name
    Recombinant Human SRPX protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTA LGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGG FKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNF PEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGD NYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAA ALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELV GVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYV SLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT
    • Amino acids
      31 to 464
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Down-regulated by v-SRC
    • DRS
    • DRS protein
    • Drs-1
    • Drs-2
    • Epididymis secretory sperm binding protein Li 83p
    • ETX1
    • EXT1
    • HEL S 83p
    • mDRS-1
    • mDRS-2
    • Srpx
    • SRPX_HUMAN
    • SRPX1
    • Sushi repeat containing protein, X chromosome
    • Sushi repeat containing protein, X linked
    • Sushi repeat-containing protein SRPX
    • Sushi-repeat-containing protein
    • Sushi-repeat-containing protein SRPX
    see all
  • Function
    May be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction.
  • Tissue specificity
    Retina and heart; less in placenta, pancreas, lung, liver, skeletal muscle, kidney and brain.
  • Sequence similarities
    Contains 1 HYR domain.
    Contains 3 Sushi (CCP/SCR) domains.
  • Cellular localization
    Cell surface. Possibly surface of photoreceptor cell.
  • Information by UniProt

Images

  • ab160020 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up