Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPA LDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGR RSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCS SGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLT ARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNR ASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAP DPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAN IIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLS NQELTQRREQRDICE
    • Molecular weight

      79 kDa including tags
    • Amino acids

      1 to 465

Specifications

Our Abpromise guarantee covers the use of ab132897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BPP
    • CBPS
    • PMGX
    • RESDX
    • SRPUL
    • SRPX 2
    • SRPX2
    • SRPX2_HUMAN
    • Sushi repeat containing protein SRPX2
    • Sushi repeat containing protein X linked 2
    • Sushi repeat protein
    • Sushi repeat-containing protein SRPX2
    see all
  • Function

    Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion in cancer cells. Increases the phosphorylation levels of FAK. May have a role in the perisylvian region, critical for language and cognitive development.
  • Tissue specificity

    Expressed in neurons of the rolandic area of the brain (at protein level). Highly expressed in the brain, placenta, lung, trachea, uterus and adrenal gland. Weakly expressed in the peripheral blood, brain and bone marrow. Expressed in numerous cancer cell lines.
  • Involvement in disease

    Defects in SRPX2 are a cause of bilateral perisylvian polymicrogyria (BPP) [MIM:300388]. BPP is the most common form of polymicrogyria, a malformation of the cortex, in which the brain surface is irregular and the normal gyral pattern replaced by multiple small, partly fused, gyri separated by shallow sulci. BPP results in mild mental retardation, epilepsy and pseudobulbar palsy, causing difficulties with expressive speech and feeding.
    Defects in SRPX2 are a cause of rolandic epilepsy with speech dyspraxia and mental retardation X-linked (RESDX) [MIM:300643]. A condition characterized by the association of rolandic seizures with oral and speech dyspraxia, and mental retardation. Rolandic occur during a period of significant brain maturation. During this time, dysfunction of neural network activities such as focal discharges may be associated with specific developmental disabilities resulting in specific cognitive impairments of language, visuo-spatial abilities or attention.
  • Sequence similarities

    Contains 1 HYR domain.
    Contains 3 Sushi (CCP/SCR) domains.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132897 stained with Coomassie Blue.

References

ab132897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up