Description

  • Product name

    Recombinant Human SRSF10 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP RGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as FUSIP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 40 kDa SR repressor protein
    • 40 kDa SR-repressor protein
    • Anti TLS associated protein with SR repeats
    • arginine/serine-rich 13A
    • FUS interacting protein serine arginine rich 1
    • FUS interacting protein serine arginine rich 2
    • FUS interacting serine arginine rich protein 1
    • FUS-interacting serine-arginine-rich protein 1
    • FUSIP1
    • FUSIP2
    • NSSR
    • OTTHUMP00000015774
    • Serine arginine repressor protein 40 kDa
    • Serine/arginine-rich splicing factor 10
    • SFRS13
    • SFRS13A
    • Splicing factor
    • Splicing factor arginine serine rich 13
    • Splicing factor SRp38
    • SRp38
    • SRp40
    • SRrp40
    • SRS10_HUMAN
    • Srsf10
    • TASR
    • TASR1
    • TASR2
    • TLS associated protein TASR1
    • TLS associated protein TASR2
    • TLS associated protein with Ser Arg repeats
    • TLS associated protein with SR repeats
    • TLS associated serine arginine protein
    • TLS associated serine arginine protein 1
    • TLS associated serine arginine protein 2
    • TLS associated SR protein
    • TLS-associated protein with Ser-Arg repeats
    • TLS-associated protein with SR repeats
    • TLS-associated serine-arginine protein
    • TLS-associated SR protein
    see all
  • Function

    Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated. Fully dephosphorylated in mitosis and partially dephosphorylated on heat shock. Isoform 3 is phosphorylated on Ser-168.
  • Cellular localization

    Nucleus speckle. Cytoplasm.
  • Information by UniProt

Images

  • ab161147 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up