Recombinant Human SSB-1 protein (ab107155)

Description

  • Product name

    Recombinant Human SSB-1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab107155 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMQELQGLDYCKPTRLDLLLDMPPVSYDVQL LHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQI TWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHD GKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFR GLKGKKLYPVVSAVWGHCEIRMRYLNGLDPE
    • Predicted molecular weight

      26 kDa
    • Amino acids

      24 to 233
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as SPSB1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 1110014L01Rik
    • 4930422J18Rik
    • AI596360
    • AI854583
    • MGC102221
    • novel SPRY domain containing protein
    • OTTHUMP00000001398
    • OTTMUSP00000010942
    • OTTMUSP00000010943
    • OTTMUSP00000023475
    • RGD1309319
    • RP23-169H13.1
    • RP3-324M8.1
    • splA/ryanodine receptor domain and SOCS box containing 1
    • SPRY domain containing SOCS box protein SSB 1
    • SPRY domain-containing SOCS box protein 1
    • SPSB1
    • SPSB1_HUMAN
    • SSB 1
    • SSB-1
    • SSB1
    see all
  • Function

    Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the SPSB family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 SOCS box domain.
  • Domain

    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes (By similarity). The B30.2/SPRY domain is involved in MET binding.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107155 (3µg).

References

ab107155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up