Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLE IMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEV TDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAF KGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNK VEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLH ILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGS GKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQK TENGAGDQ
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 408
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Autoantigen La
    • La
    • La autoantigen
    • La autoantigen homolog
    • La protein
    • La ribonucleoprotein
    • La ribonucleoprotein domain family member 3
    • LA_HUMAN
    • LARP3
    • Lupus La antigen
    • Lupus La protein
    • Lupus La protein homolog
    • MGC118101
    • MGC93380
    • mRNA for autoantigen
    • OTTMUSP00000014043
    • RP23 273G23.1
    • Sjoegren syndrome type B antigen
    • Sjogren syndrome antigen B
    • Sjogren syndrome antigen B (autoantigen La)
    • SS B
    • SS-B
    • SS-B/La protein
    • SSB
    see all
  • Function

    Binds to the 3' poly(U) terminii of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation.
  • Sequence similarities

    Contains 1 HTH La-type RNA-binding domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated. The phosphorylation sites are at the C-terminal part of the protein.
    The N-terminus is blocked.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab236339.

References

ab236339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up