Description

  • Product name

    Recombinant Human SSPN protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMAS ISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYF LLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTF VYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYV GVRICSLTASEGPQQKI
    • Amino acids

      1 to 217
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • K ras oncogene associated gene
    • K ras oncogene associated protein
    • Kirsten ras associated protein
    • KRAG
    • Sarcospan
    • SPN1
    • SPN2
    see all
  • Relevance

    The SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are co-amplified. The function of this gene is unknown.
  • Cellular localization

    Cell membrane, sarcolemma; Multi-pass membrane protein. Note: Also found in myotendinous junctions and in the postsynaptic membrane of neuromuscular junctions.

Images

  • ab159942 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up