Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMALNGAEVDDFSWEPPTEAETKVLQAR RERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQELD SDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEG AAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETS IQLCGLIRACAEALRSLQQLQH
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 199
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No.: NP_006387

Specifications

Our Abpromise guarantee covers the use of ab174559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • 1500016H19Rik
    • Autoantigen p27
    • C184L
    • centromeric autoantigen (27kD)
    • OTTHUMP00000232769
    • OTTHUMP00000233069
    • OTTHUMP00000233071
    • p27
    • Sjoegren syndrome/scleroderma autoantigen 1
    • Sjogren syndrome/scleroderma autoantigen 1
    • Sjogren's syndrome/scleroderma autoantigen 1 homolog
    • SSA27_HUMAN
    • SSSCA1
    see all
  • Function
    Might play a role in mitosis. Antigenic molecule. Could be a centromere-associated protein. May induce anti-centromere antibodies.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174559 (3 µg)

References

ab174559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up