Overview

  • Product name

    Recombinant Human Ssu72 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPSSPLRVAVVCSSNQNRSMEAHNILS KRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYT QNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSRE QETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQ EFEEKSGRTFLHTVCFY
    • Molecular weight

      25 kDa including tags
    • Amino acids

      1 to 194
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab123148 was purified using conventional chromatography.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • CTD phosphatase SSU72
    • HSPC182
    • Hypothetical protein FLJ10947
    • PNAS-120
    • RNA polymerase II subunit A C-terminal domain phosphatase SSU72
    • ssu72
    • Ssu72 RNA polymerase II CTD phosphatase homolog
    • Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)
    • SSU72_HUMAN
    see all
  • Function

    May be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination.
  • Sequence similarities

    Belongs to the SSU72 phosphatase family.
  • Cellular localization

    Nucleus. Cytoplasm. Predominantly in the cytosol.
  • Information by UniProt

Images

  • 15% SDS PAGE, 3 µg of ab123148 loaded.

References

ab123148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up