Description

  • Product name

    Recombinant Human SSX1 protein
    See all SSX1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVY MKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMT FGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEK INKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 188

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 5.1
    • Cancer/testis antigen family 5 member 1
    • CT5.1
    • MGC150425
    • MGC5162
    • Protein SSX1
    • sarcoma, synovial, X chromosome related 1
    • SSRC
    • SSX1
    • SSX1_HUMAN
    • Synovial sarcoma
    • Synovial sarcoma, X breakpoint 1
    • X breakpoint 1
    see all
  • Function

    Could act as a modulator of transcription.
  • Tissue specificity

    Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines.
  • Involvement in disease

    Note=A chromosomal aberration involving SSX1 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).
  • Sequence similarities

    Belongs to the SSX family.
    Contains 1 KRAB-related domain.
  • Information by UniProt

Images

  • ab116787 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab116787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up