Description

  • Product name

    Recombinant human ST2 protein (Active)
    See all ST2 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit proliferation using D10.G4.1 mouse helper T cells. The ED50 for this effect is less or equal to 10 ng/ml with IL-33.

  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFAS GQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLM YSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVI DNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQ EEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRL SRKNPIDHHSLEHHHHHH
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      19 to 328
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_057316).

Specifications

Our Abpromise guarantee covers the use of ab233601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DER-4
    • DER4
    • FIT 1
    • Growth stimulation expressed
    • homolog of mouse growth stimulation-expressed
    • Il1rl1
    • IL33R
    • ILRL1_HUMAN
    • Interleukin 1 receptor like 1
    • interleukin 1 receptor related protein
    • Interleukin-1 receptor-like 1
    • Protein ST2
    • ST2
    • ST2L
    • ST2V
    • T1
    • T1 protein
    see all
  • Function

    Receptor for interleukin-33 (IL-33), its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function.
  • Tissue specificity

    Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab233601.

    MW: 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab233601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up