Description

  • Product name

    Recombinant human ST2 protein (Fc Chimera Active)
    See all ST2 proteins and peptides
  • Biological activity

    Measured by its ability to bind recombinant human IL-33 in a functional ELISA.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFAS GQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLM YSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVI DNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQ EEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRL SRKNPSKECF
    • Predicted molecular weight

      35 kDa
    • Amino acids

      19 to 328
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of human IgG1 (AAH30975.1).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab216201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilised from 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in 50µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • DER-4
    • DER4
    • FIT 1
    • Growth stimulation expressed
    • homolog of mouse growth stimulation-expressed
    • Il1rl1
    • IL33R
    • ILRL1_HUMAN
    • Interleukin 1 receptor like 1
    • interleukin 1 receptor related protein
    • Interleukin-1 receptor-like 1
    • Protein ST2
    • ST2
    • ST2L
    • ST2V
    • T1
    • T1 protein
    see all
  • Function

    Receptor for interleukin-33 (IL-33), its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function.
  • Tissue specificity

    Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab216201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up