Description

  • Product name

    Recombinant Human ST2 protein (His tag)
    See all ST2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFAS GQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLM YSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVI DNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQ EEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRL SRKNPSKECF
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      19 to 328
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 328. The signal peptide is not included (NP_003847).

Specifications

Our Abpromise guarantee covers the use of ab219706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • DER-4
    • DER4
    • FIT 1
    • Growth stimulation expressed
    • homolog of mouse growth stimulation-expressed
    • Il1rl1
    • IL33R
    • ILRL1_HUMAN
    • Interleukin 1 receptor like 1
    • interleukin 1 receptor related protein
    • Interleukin-1 receptor-like 1
    • Protein ST2
    • ST2
    • ST2L
    • ST2V
    • T1
    • T1 protein
    see all
  • Function

    Receptor for interleukin-33 (IL-33), its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function.
  • Tissue specificity

    Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Immobilized human IL33 at 5 μg/mL (100 μL/well) can bind ab219706 with a linear range of 0.125-0.5 μg/mL 

  • SDS-PAGE analysis of ab219706 stained overnight with Coomassie Blue.

    The reduced protein migrates as 48-60 kDa in SDS-PAGE due to glycosylation.

References

ab219706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up