Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKL VPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRE NMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCR RCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFM YPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVD KEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
    • Amino acids
      1 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-GalNAc-alpha-2
    • 3-sialyltransferase
    • 3-sialyltransferase 2
    • 3-ST 2
    • Alpha 2
    • Alpha 2,3-ST
    • Beta-galactoside alpha-2
    • Beta-galactoside alpha-2,3-sialyltransferase
    • CMP N-acetylneuraminate beta galactosamide alpha 2,3 sialyltransferase
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2
    • Gal NAc6S
    • Gal-beta-1
    • Gal-NAc6S
    • SIA4B_HUMAN
    • Sialyltransferase 4B
    • sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
    • SIAT4-B
    • SIAT4B
    • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
    • ST3Gal II
    • ST3GAL2
    • ST3GalA.2
    • ST3GalII
    see all
  • Function
    It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
  • Tissue specificity
    Highly expressed in skeletal muscle and heart and to a much lesser extent in brain, placenta, liver and pancreas. Scarcely detectable in lung and kidney.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Post-translational
    modifications
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
  • Information by UniProt

Images

  • ab159509 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up