Overview

  • Product name
    Recombinant Human ST3GAL6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDL RWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
    • Amino acids
      145 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SIAT10
    • 3-sialyltransferase VI
    • alpha-2,3-sialyltransferase VI
    • alpha2,3-sialyltransferase
    • CMP-NeuAc:beta-galactoside alpha-2
    • CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI
    • SIA10_HUMAN
    • Sialyltransferase 10
    • ST3Gal VI
    • ST3GAL6
    • ST3GalVI
    • Type 2 lactosamine alpha-2,3-sialyltransferase
    see all
  • Function
    Involved in the synthesis of sialyl-paragloboside, a precursor of sialyl-Lewis X determinant. Has a alpha-2,3-sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. Has a restricted substrate specificity, it utilizes Gal-beta1,4-GlcNAc on glycoproteins, and neolactotetraosylceramide and neolactohexaosylceramide, but not lactotetraosylceramide, lactosylceramide or asialo-GM1.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160973 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up