Overview

  • Product name
    Recombinant Human ST6GAL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPR AHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYF FAAGQPGWH
    • Amino acids
      33 to 141
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6-sialyltransferase 2
    • 6-ST 2
    • Alpha 2
    • Alpha 2,6 ST 2
    • beta galactoside alpha 2,6 sialyltransferase II
    • Beta-galactoside alpha-2
    • CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2
    • EC 2.4.99.1
    • FLJ30711
    • FLJ37730
    • FLJ38334
    • hST6Gal II
    • KIAA1877
    • Sialyltransferase 2
    • SIAT2
    • SIAT2_HUMAN
    • ST6 beta galactosamide alpha 2,6 sialyltranferase 2
    • ST6Gal II
    • ST6GAL2
    • ST6GalII
    see all
  • Function
    Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Has alpha-2,6-sialyltransferase activity toward oligosaccharides that have the Gal-beta-1,4-GlcNAc sequence at the non-reducing end of their carbohydrate groups, but it has weak or no activities toward glycoproteins and glycolipids.
  • Tissue specificity
    Weakly expressed in some tissues, such as small intestine, colon and fetal brain.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • ab164620 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up