Description

  • Product name

    Recombinant Human ST6GALNAC6 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILF ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT LPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNK TTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVI QRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMV IAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEH SRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
    • Amino acids

      1 to 333
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6-sialyltransferase 6
    • 6-sialyltransferase VI
    • Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase 6
    • Alpha-N-acetylgalactosaminide alpha-2
    • CMP NeuAC:(beta) N acetylgalactosaminide (alpha)2 6 sialyltransferase member VI
    • GalNAc alpha 2 6 sialyltransferase VI
    • GalNAc alpha-2
    • hST6GalNAc VI
    • RP11 203J24.3
    • SIA7F_HUMAN
    • Sialyltransferase 7F
    • Sialyltransferase7F
    • Sialytransferase 7 ((alpha N acetylneuraminyl 2 3 betagalactosyl 1 3) N acetyl galactosaminide alpha 2 6 sialytransferase) F
    • SIAT 7F
    • SIAT7-F
    • SIAT7F
    • ST6 (alpha N acetyl neuraminyl 2 3 beta galactosyl 1 3) N acetylgalactosaminide alpha 2 6 sialyltransferase 6
    • ST6GalNAc VI
    • ST6GALNAC6
    • ST6GalNAcVI
    see all
  • Function

    Alpha-2,6-sialyltransferase involved in the synthesis of alpha-series gangliosides. Has activity toward GD1a, GT1b and GM1b. Has no activity toward glycoproteins. Responsible for the biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. Participates in the synthesis of disialyl Lewis a (Le(a)).
  • Tissue specificity

    Expressed in kidney, in proximal tubule epithelial cells. Expressed in colon cell lines.
  • Sequence similarities

    Belongs to the glycosyltransferase 29 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab162319 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up