Overview

  • Product name
    Recombinant Human ST8SiaIII protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAP RMYMFHAGFRSQFALKFLDPSFVPITNSLTQELQEKPSKWKFNRTAFLHQ RQEILQHVDVIKNFSLTKNSVRIGQLMHYDYSSHKYVFSISNNFRSLLPD VSPIMNKHYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFQRD VGRKTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFF HTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYWKNKHLSPKRLS TGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKW QESHQLPAEFQLLYRMHGEGLTKLTLSHCA
    • Amino acids
      1 to 380
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SIA8C. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-Gal-beta-1
    • 4-GlcNAc-R:alpha 2
    • 8-sialyltransferase
    • 8-sialyltransferase 3
    • 8-sialyltransferase 8C
    • 8-sialyltransferase III
    • Alpha-2
    • Sia-alpha-2
    • SIA8C
    • SIA8C_HUMAN
    • Sialyltransferase 8C
    • Sialyltransferase St8Sia III
    • SIAT8-C
    • ST8 alpha-N-acetyl-neuraminide alpha-2
    • St8sia3
    • ST8SiaIII
    see all
  • Function
    May transfer sialic acid through alpha-2,8-linkages to alpha-2,3-linked and alpha-2,8-linked sialic acid of N-linked oligosaccharides of glycoproteins and glycolipids. It can form polysialic acid in vitro directly on alpha-2,3-, alpha-2,6-, or alpha-2,8-linked sialic acid.
  • Tissue specificity
    Expressed in fetal and adult brain and fetal liver.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab162401 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up