Overview

  • Product name

    Recombinant Human Stabilin 2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLK GFNVNELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIF
    • Amino acids

      367 to 465
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 190 kDa form stabilin-2
    • 190 kDa hyaluronan receptor for endocytosis
    • EGF-like
    • FAS1 EGF-like and X-link domain-containing adhesion molecule 2
    • Fasciclin
    • FEEL-2
    • FEEL2
    • FELL
    • FEX2
    • HARE
    • Hyaluronan receptor for endocytosis
    • laminin-type EGF-like and link domain-containing scavenger receptor 2
    • link domain-containing scavenger receptor 2
    • STAB-2
    • Stab2
    • STAB2_HUMAN
    see all
  • Function

    Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Hyaluronan receptor that binds to and mediates endocytosis of hyaluronic acid (HA). Acts also, in different species, as a primary systemic scavenger receptor for heparin (Hep), chondroitin sulfate (CS), dermatan sulfate (DS), nonglycosaminoglycan (GAG), acetylated low-density lipoprotein (AcLDL), pro-collagen propeptides and advanced glycation end products (AGE). May serve to maintain tissue integrity by supporting extracellular matrix turnover or it may contribute to maintaining fluidity of bodily liquids by resorption of hyaluronan. Counter receptor which plays an important role in lymphocyte recruitment in the hepatic vasculature. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. The proteolytically processed 190 kDa form also functions as an endocytosis receptor for heparin internalisation as well as HA and CS.
  • Tissue specificity

    Highly expressed in sinusoidal endothelial cells of liver, spleen and lymph nodes. Also expressed in non SEC-cells such as HMDMs (monocyte-derivedmacrophages), HAMs (T-cell leukemia virus type 1-associated myelopathy), and several macrophage cell line.
  • Sequence similarities

    Contains 17 EGF-like domains.
    Contains 7 FAS1 domains.
    Contains 2 laminin EGF-like domains.
    Contains 1 Link domain.
  • Domain

    Recognizes phosphatidyl serine via its epidermal growth factor-like domains.
  • Post-translational
    modifications

    Glycosylated.
    Proteolytically processed to yield a 190 kDa protein.
  • Cellular localization

    Cell membrane. Cytoplasm. Only a small amount appears to be present at the cell surface.
  • Information by UniProt

Images

  • ab163129 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up