Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQN SNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQ HTNYHQQPLL
    • Amino acids
      416 to 525
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp564C047
    • Hbp
    • Hrs-binding protein
    • HSE1 homolog
    • Signal transducing adapter molecule 2
    • Signal transducing adaptor molecule
    • Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
    • Signal transducing adaptor molecule 2A
    • Signal transducing adaptor molecule 2B
    • STAM like protein containing SH3 and ITAM domains 2
    • STAM-2
    • Stam2
    • STAM2_HUMAN
    • STAM2A
    • STAM2B
    see all
  • Function
    Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the STAM family.
    Contains 1 ITAM domain.
    Contains 1 SH3 domain.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
    Contains 1 VHS domain.
  • Domain
    The VHS and UIM domains mediate the interaction with ubiquitinated proteins.
    The SH3 domain mediates the interaction with USP8.
    Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain.
  • Post-translational
    modifications
    Phosphorylated in response to IL-2, GM-CSF, EGF and PDGF.
  • Cellular localization
    Cytoplasm. Early endosome membrane.
  • Information by UniProt

Images

  • ab160904 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up