Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENN SCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRK CPAIREMVSQLQRECYLKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDL VNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSFCTSAIQKPPTAPPE RQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARG RVGGLGAQGPSGSSEWEDEQSEYSDIRR
    • Molecular weight
      33 kDa including tags
    • Amino acids
      25 to 302
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    Previously labelled as Stanniocalcin 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 1.46% Sodium chloride

General Info

  • Alternative names
    • Stanniocalcin 2
    • Stanniocalcin related protein
    • Stanniocalcin-2
    • Stanniocalcin-related protein
    • Stanniocalcin2
    • STC 2
    • STC related protein
    • STC-2
    • STC-related protein
    • STC2
    • STC2_HUMAN
    • STCRP
    see all
  • Function
    Has an anti-hypocalcemic action on calcium and phosphate homeostasis.
  • Tissue specificity
    Expressed in a variety of tissues including muscle, heart, pancreas, kidney, spleen, prostate, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the stanniocalcin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis using ab156715 at 3ug.

References

This product has been referenced in:
  • Chen B  et al. STC2 promotes the epithelial-mesenchymal transition of colorectal cancer cells through AKT-ERK signaling pathways. Oncotarget 7:71400-71416 (2016). Read more (PubMed: 27662663) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up