Description

  • Product name

    Recombinant Human StAR protein
  • Purity

    > 90 % SDS-PAGE.
    ab115707 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEETLYSDQELAYLQQGEEAMQKALGILSN QEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVERME AMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKR RGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWL LSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      64 to 285
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.03% DTT

General Info

  • Alternative names

    • Cholesterol trafficker
    • Luteinizing hormone induced protein
    • mitochondrial
    • Mitochondrial steroid acute regulatory protein
    • StAR
    • StAR related lipid transfer (START) domain containing 1
    • STAR_HUMAN
    • StARD1
    • START domain containing 1
    • START domain containing protein 1
    • START domain-containing protein 1
    • Steroid acute regulatory protein
    • Steroidogenic acute regulator
    • Steroidogenic acute regulatory protein
    • Steroidogenic acute regulatory protein mitochondrial
    see all
  • Function

    Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone.
  • Tissue specificity

    Expressed in gonads, adrenal cortex and kidney.
  • Pathway

    Steroid metabolism; cholesterol metabolism.
  • Involvement in disease

    Defects in STAR are the cause of adrenal hyperplasia type 1 (AH1) [MIM:201710]. The most severe form of adrenal hyperplasia. It is a condition characterized by onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. Affected individuals are phenotypic females irrespective of gonadal sex, and frequently die in infancy if mineralocorticoid and glucocorticoid replacement are not instituted.
  • Sequence similarities

    Contains 1 START domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115707 at approximately 27.1kDa (3µg).

References

ab115707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up