Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDN PQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDR CPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEE LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSR ETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDD ELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRK
    • Molecular weight

      68 kDa including tags
    • Amino acids

      1 to 390

Specifications

Our Abpromise guarantee covers the use of ab132941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Signal transducer and activator of transcription 5B
    • STA5B_HUMAN
    • STAT5
    • Stat5b
    • Transcription factor STAT5B
    see all
  • Function

    Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.
  • Involvement in disease

    Growth hormone insensitivity with immunodeficiency
  • Sequence similarities

    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated in response to signaling via activated KIT, resulting in translocation to the nucleus. Tyrosine phosphorylated in response to signaling via activated FLT3; wild-type FLT3 results in much weaker phosphorylation than constitutively activated mutant FLT3. Alternatively, can be phosphorylated by JAK2. Phosphorylation at Tyr-699 by PTK6 or HCK leads to an increase of its transcriptional activity. Dephosphorylation on tyrosine residues by PTPN2 negatively regulates prolactin signaling pathway.
  • Cellular localization

    Cytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132941 stained with Coomassie Blue

References

ab132941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up