Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDN PQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDR CPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEE LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSR ETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDD ELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITLEHH HHHH
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 321
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.02% DTT, 50% Glycerol, 49% PBS

    Supplied as an 0.2 µM filtered solution.

General Info

  • Alternative names
    • Signal transducer and activator of transcription 5B
    • STA5B_HUMAN
    • STAT5
    • Stat5b
    • Transcription factor STAT5B
    see all
  • Function
    Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.
  • Involvement in disease
    Growth hormone insensitivity with immunodeficiency
  • Sequence similarities
    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Tyrosine phosphorylated in response to signaling via activated KIT, resulting in translocation to the nucleus. Tyrosine phosphorylated in response to signaling via activated FLT3; wild-type FLT3 results in much weaker phosphorylation than constitutively activated mutant FLT3. Alternatively, can be phosphorylated by JAK2. Phosphorylation at Tyr-699 by PTK6 or HCK leads to an increase of its transcriptional activity. Dephosphorylation on tyrosine residues by PTPN2 negatively regulates prolactin signaling pathway.
  • Cellular localization
    Cytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
  • Information by UniProt

References

ab173069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up