Recombinant Human Stathmin 1 protein (His tag) (ab200502)
Key features and details
- Expression system: Escherichia coli
- Purity: > 92% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Stathmin 1 protein (His tag)
See all Stathmin 1 proteins and peptides -
Purity
> 92 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQ KKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKL THKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD -
Predicted molecular weight
18 kDa including tags -
Amino acids
2 to 149 -
Tags
His tag N-Terminus -
Additional sequence information
NP_981946.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab200502 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilised from 0.22 µm filtered solution. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- C1orf215
- Lag
- LAP 18
see all -
Function
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear. -
Tissue specificity
Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia. -
Sequence similarities
Belongs to the stathmin family.
Contains 1 SLD (stathmin-like) domain. -
Post-translational
modificationsMany different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity. -
Cellular localization
Cytoplasm > cytoskeleton. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab200502 has not yet been referenced specifically in any publications.