Description

  • Product name

    Recombinant Human Stathmin 1 protein
    See all Stathmin 1 proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQ KKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKL THKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      2 to 149
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_981946.

Specifications

Our Abpromise guarantee covers the use of ab200502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • C1orf215
    • Lag
    • LAP 18
    • LAP18
    • Leukemia associated phosphoprotein p18
    • Leukemia-associated phosphoprotein p18
    • Metablastin
    • Oncoprotein 18
    • OP 18
    • Op18
    • p18
    • p19
    • Phosphoprotein 19
    • Phosphoprotein p19
    • pp17
    • pp19
    • PR22
    • Pr22 protein
    • Prosolin
    • Protein Pr22
    • SMN
    • Stathmin
    • Stathmin1
    • STMN 1
    • Stmn1
    • STMN1_HUMAN
    see all
  • Function

    Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear.
  • Tissue specificity

    Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.
  • Sequence similarities

    Belongs to the stathmin family.
    Contains 1 SLD (stathmin-like) domain.
  • Post-translational
    modifications

    Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab200502 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 17-20 kDa in SDS-PAGE .

References

ab200502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up