Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPP KSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP
    • Amino acids

      2 to 90
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 39K2
    • 39K3
    • DKFZp781K0371
    • Double stranded RNA binding protein Staufen homolog 2
    • Double-stranded RNA-binding protein Staufen homolog 2
    • MGC119606
    • STAU 2
    • stau2
    • STAU2_HUMAN
    • Staufen (Drosophila, RNA-binding protein) homolog 2
    • Staufen double-stranded RNA binding protein 2
    • Staufen homolog 2
    • Staufen RNA binding protein homolog 2
    • Staufen, RNA binding protein, homolog 2 (Drosophila)
    see all
  • Function

    RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body.
  • Sequence similarities

    Contains 4 DRBM (double-stranded RNA-binding) domains.
  • Domain

    The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleolus. Endoplasmic reticulum. Shuttles between the nucleolus, nucleus and the cytoplasm. Nuclear export of isoform 1 is independent of XPO1/CRM1 and requires the exportin XPO5. Nuclear export of isoform 2 and isoform 3 can occur by both XPO1/CRM1-dependent and XPO1/CRM1-independent pathways. Found in large cytoplasmic ribonucleoprotein (RNP) granules which are present in the actin rich regions of myelinating processes and associated with microtubules, polysomes and the endoplasmic reticulum. Also recruited to stress granules (SGs) upon inhibition of translation or oxidative stress. These structures are thought to harbor housekeeping mRNAs when translation is aborted.
  • Information by UniProt

Images

  • ab162065 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up