Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWS HSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH
    • Amino acids

      259 to 358
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Genethonin 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ41801
    • Genethonin 1
    • Genethonin-1
    • Genethonin1
    • GENEX 3414
    • GENEX3414
    • GENX 3414
    • GENX3414
    • Starch binding domain 1
    • Starch binding domain containing protein 1
    • Starch-binding domain-containing protein 1
    • STBD 1
    • STBD1
    • STBD1_HUMAN
    see all
  • Function

    May have the capability to bind to carbohydrates.
  • Tissue specificity

    Expressed at high level in skeletal and cardiac muscles. Moderately expressed in liver and placenta. No expression is found in pancreas, kidney or lung. Present in skeletal muscle, heart and placenta (at protein level).
  • Sequence similarities

    Contains 1 CBM20 (carbohydrate binding type-20) domain.
  • Cellular localization

    Membrane. Distributed in the transverse tubules and/or near the junctional sarcoplasmic reticulum.
  • Information by UniProt

Images

  • ab160281 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up