Description

  • Product name

    Recombinant Human STBD1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab167849 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSRGGPGDTGKDGDAEQEKDAPLGGAAIP GGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRL QNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPM GEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDH EEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGK MERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLH YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV VHAWWGIH
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      24 to 358
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as Genethonin 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • FLJ41801
    • Genethonin 1
    • Genethonin-1
    • Genethonin1
    • GENEX 3414
    • GENEX3414
    • GENX 3414
    • GENX3414
    • Starch binding domain 1
    • Starch binding domain containing protein 1
    • Starch-binding domain-containing protein 1
    • STBD 1
    • STBD1
    • STBD1_HUMAN
    see all
  • Function

    May have the capability to bind to carbohydrates.
  • Tissue specificity

    Expressed at high level in skeletal and cardiac muscles. Moderately expressed in liver and placenta. No expression is found in pancreas, kidney or lung. Present in skeletal muscle, heart and placenta (at protein level).
  • Sequence similarities

    Contains 1 CBM20 (carbohydrate binding type-20) domain.
  • Cellular localization

    Membrane. Distributed in the transverse tubules and/or near the junctional sarcoplasmic reticulum.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab167849.

References

ab167849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up