Description

  • Product name

    Recombinant Human STCH protein
  • Purity

    > 95 % SDS-PAGE.
    ab104640 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMQQYLPLPTPK VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGY ESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF SVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQ RNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLD VSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRK EEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDK LSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKIL VPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDP DLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      23 to 471
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Heat shock 70 kDa protein 13
    • HEAT SHOCK 70-KD PROTEIN 13
    • heat shock protein 70kDa family, member 13
    • heat shock protein70kDa family, member13
    • HSP13_HUMAN
    • HSPA13
    • MGC133835
    • Microsomal stress 70 protein ATPase core
    • Microsomal stress-70 protein ATPase core
    • STCH
    • Stress 70 protein chaperone microsome associated 60 kDa protein
    • Stress-70 protein chaperone microsome-associated 60 kDa protein
    see all
  • Function

    Has peptide-independent ATPase activity.
  • Tissue specificity

    Constitutively expressed in all tissues.
  • Sequence similarities

    Belongs to the heat shock protein 70 family.
  • Cellular localization

    Microsome. Endoplasmic reticulum.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104640.

References

ab104640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up