Overview

  • Product name
    Recombinant Human STEAP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTA HADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLAT SHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKF PHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQV QQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREF HYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIV VLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
    • Amino acids
      1 to 339
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410007B19Rik
    • EC 1.16.1.-
    • Metalloreductase STEAP1
    • MGC19484
    • PRSS 24
    • PRSS24
    • Six transmembrane epithelial antigen of prostate
    • Six transmembrane epithelial antigen of the prostate
    • Six transmembrane epithelial antigen of the prostate 1
    • Six-transmembrane epithelial antigen of prostate 1
    • STEA1_HUMAN
    • Steap
    • STEAP 1
    • STEAP1
    see all
  • Function
    Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
  • Tissue specificity
    Ubiquitously expressed. Highly expressed in prostate tumors.
  • Sequence similarities
    Belongs to the STEAP family.
    Contains 1 ferric oxidoreductase domain.
  • Cellular localization
    Endosome membrane.
  • Information by UniProt

Images

  • ab162041 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up