Description

  • Product name

    Recombinant Human STEAP2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLI RCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTS LWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDSLIVKGFNVVS AWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSARE IENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKI PIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQ CRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWN EEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGY VALLISTFHVLIYGWKRAFEEEYYRFYTPPNFVLALVLPSIVILGKIILF LPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM
    • Amino acids

      1 to 490
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4921538B17Rik
    • AI930049
    • IPCA 1
    • IPCA1
    • Metalloreductase STEAP2
    • PCANAP 1
    • PCANAP1
    • Prostate cancer associated protein 1
    • Prostate cancer-associated protein 1
    • Protein up regulated in metastatic prostate cancer
    • Protein upregulated in metastatic prostate cancer
    • PUMPCn
    • Six transmembrane epithelial antigen of prostate 2
    • Six transmembrane epithelial antigen of the prostate 2
    • Six-transmembrane epithelial antigen of prostate 2
    • SixTransMembrane protein of prostate 1
    • STAMP 1
    • STAMP1
    • STEA2_HUMAN
    • STEAP 2
    • STEAP family member 2, metalloreductase
    • Steap2
    • STMP
    • UNQ6507/PRO23203
    see all
  • Function

    Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
  • Tissue specificity

    Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary.
  • Sequence similarities

    Belongs to the STEAP family.
    Contains 1 ferric oxidoreductase domain.
  • Cellular localization

    Endosome membrane. Cell membrane.
  • Information by UniProt

Images

  • ab166097 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up