Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAK KGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLK HEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDP TYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPP PPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDK AKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNR AACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDV YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS DPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
    • Molecular weight

      63 kDa
    • Amino acids

      1 to 543

Specifications

Our Abpromise guarantee covers the use of ab222344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab222344 was purified by conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as STIP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.0154% DTT, 10% Glycerol, 0.316% Tris HCl, 0.58% Sodium chloride

General Info

  • Alternative names

    • Epididymis secretory sperm binding protein Li 94n
    • HEL S 94n
    • Hop
    • Hsc70/Hsp90 organizing protein
    • Hsc70/Hsp90-organizing protein
    • IEF SSP 3521
    • NY REN 11 antigen
    • P60
    • Renal carcinoma antigen NY-REN-11
    • STI1
    • STI1L
    • STIP1
    • STIP1_HUMAN
    • Stress induced phosphoprotein 1
    • Stress-induced-phosphoprotein 1
    • Transformation sensitive protein IEF SSP 3521
    • Transformation-sensitive protein IEF SSP 3521
    see all
  • Function

    Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
  • Sequence similarities

    Contains 2 STI1 domains.
    Contains 9 TPR repeats.
  • Domain

    The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human STIP1/STI1 protein (ab222344 at 3 µg)

References

ab222344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up