Overview

  • Product name
    Recombinant Human STK11IP protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVH VAGPGPTGPIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRS
    • Amino acids
      54 to 152
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1898
    • LIP1
    • LKB1 interacting protein
    • LKB1 interacting protein 1
    • LKB1-interacting protein 1
    • LKB1IP
    • S11IP_HUMAN
    • Serine/threonine kinase 11 interacting protein
    • Serine/threonine-protein kinase 11-interacting protein
    • STK11 interacting protein
    • stk11ip
    • STK11IP1
    see all
  • Function
    May regulate STK11 function by controlling its subcellular localization.
  • Sequence similarities
    Belongs to the STK11IP family.
    Contains 8 LRR (leucine-rich) repeats.
  • Cellular localization
    Cytoplasm. Some cells show granular or punctuate expression. Colocalizes with STK11 and SMAD4 in granular or punctuate structures.
  • Information by UniProt

Images

  • ab165035 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up