Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVV RTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQD CRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQC VADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPL GDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIG VLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRT LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVP EINSDTDKSETEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKF EEPLLQEIPGEFIY
    • Molecular weight

      73 kDa
    • Amino acids

      1 to 414

Specifications

Our Abpromise guarantee covers the use of ab131775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as DRAK1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DAP kinase-related apoptosis-inducing protein kinase 1
    • death-associated protein kinase-related 1
    • DRAK1
    • EC 2.7.11.1
    • Serine / threonine kinase 17a death associated protein kinase related 1
    • Serine/threonine kinase 17a
    • Serine/threonine protein kinase 17a
    • Serine/threonine-protein kinase 17A
    • ST17A_HUMAN
    • STK17 A
    • STK17A
    see all
  • Function

    Acts as a positive regulator of apoptosis. Also acts as a regulator of cellular reactive oxygen species.
  • Tissue specificity

    Highly expressed in placenta. Lower levels in heart, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131775 stained with Coomassie Blue.

References

ab131775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up