Description

  • Product name

    Recombinant human STK17A protein
    See all STK17A proteins and peptides
  • Biological activity

    The specific activity was determined to be 8.5 nmol/min/mg.

  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVV RTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQD CRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQC VADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPL GDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIG VLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRT LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVP EINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKF EEPLLQEIPGEFIY
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      1 to 414
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      NM_004760.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab179508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    Western blot

  • Form

    Liquid
  • Additional notes

    ab204866 (MRCL3 peptide) can be utilized as a substrate for assessing kinase activity

     This product was previously labelled as DRAK1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DAP kinase-related apoptosis-inducing protein kinase 1
    • death-associated protein kinase-related 1
    • DRAK1
    • EC 2.7.11.1
    • Serine / threonine kinase 17a death associated protein kinase related 1
    • Serine/threonine kinase 17a
    • Serine/threonine protein kinase 17a
    • Serine/threonine-protein kinase 17A
    • ST17A_HUMAN
    • STK17 A
    • STK17A
    see all
  • Function

    Acts as a positive regulator of apoptosis. Also acts as a regulator of cellular reactive oxygen species.
  • Tissue specificity

    Highly expressed in placenta. Lower levels in heart, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • The purity was determined to be > 85% by densitometry. MW ~83 kDa.

  • Kinase Assay demonstrating specific activity of ab179508.

References

ab179508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up