Description

  • Product name

    Recombinant human STK19/G11 protein
  • Biological activity

    The specific activity of ab139624 was determined to be 2 nmol/min/mg.
  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVP GRACPWREPIRGRRGARPGGGDAGGTPGETVRHCSAPEDPIFRFSSLHSY PFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAV SELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRI VQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLS FQQDQMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVK GRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDC ISTTSGTLLRLPET
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 364

Associated products

Specifications

Our Abpromise guarantee covers the use of ab139624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab204856 (CREB peptide) can be utilized as a substrate for assessing kinase activity

    Previously labelled as STK19.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • D6S60
    • D6S60E
    • G11
    • HLA RP1
    • MGC117388
    • MHC class III HLA RP1
    • Nuclear serine/threonine protein kinase
    • OTTHUMP00000062682
    • Protein G11
    • Protein RP1
    • RP 1
    • RP1
    • Serine/threonine kinase 19
    • Serine/threonine protein kinase 19
    • STK 19
    • STK19
    see all
  • Relevance

    STK19 belongs to the serine/threonine protein kinase family. The specific function of this protein is unknown. In vitro it can phosphorylate casein-alpha on serine and threonine residues and histones on serine residues.
  • Cellular localization

    Nuclear

Images

  • SDS PAGE analysis of ab139624

References

ab139624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up